Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cobra venom factor Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Complement C3 homolog.

Reactivity

Naja kaouthia

Target

Complement-activating protein in cobra venom. It is a structural and functional analog of complement component C3b, the activated form of C3. It binds factor B (CFB), which is subsequently cleaved by factor D (CFD) to form the bimolecular complex CVF/Bb. CVF/Bb is a C3/C5 convertase that cleaves both complement components C3 and C5. Structurally, it resembles the C3b degradation product C3c, which is not able to form a C3/C5 convertase. Unlike C3b/Bb, CVF/Bb is a stable complex and completely resistant to the actions of complement regulatory factors H (CFH) and I (CFI) . Therefore, CVF continuously activates complement resulting in the depletion of complement activity.

Type

Protein

Source

E.coli

Sequence

DDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDPVAQIIENSIDGSKLN

Purification

Affinity purified using IMAC.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.4 kDa

Protein Length

Recombinant

Protein Name

Cobra venom factor

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclandelate
B1718-5.1 10 mM (in 1mL DMSO)

Cyclandelate

Sign In for Pricing
View Details
DPCD Protein Vector (Rat) (pPM-C-HA)
PV264732 500 ng

DPCD Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
SENP5 Antibody (C-term)
MBS9208673-01 0.08 mL

SENP5 Antibody (C-term)

Sign In for Pricing
View Details
SENP5 Antibody (C-term)
MBS9208673-02 0.4 mL

SENP5 Antibody (C-term)

Sign In for Pricing
View Details
SENP5 Antibody (C-term)
MBS9208673-03 5x 0.4 mL

SENP5 Antibody (C-term)

Sign In for Pricing
View Details
PDK1 Blocking Peptide
MBS9620000-01 1 mg

PDK1 Blocking Peptide

Sign In for Pricing
View Details