Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC1A6 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Solute carrier family 1 member 6

Gene Aliases

EAAT4; excitatory amino acid transporter 4; sodium-dependent glutamate/aspartate transporter; solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6; Solute carrier family 1 member 6.

Gene ID

6511

Accession Number

NP_001259016.1

Reactivity

Homo sapiens|Human

Target

Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:7791878) . Functions as a symporter that transports one amino acid molecule together with two or three Na (+) ions and one proton, in parallel with the counter-transport of one K (+) ion. Mediates Cl (-) flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na (+) symport (By similarity) . Plays a redundant role in the rapid removal of released glutamate from the synaptic cleft, which is essential for terminating the postsynaptic action of glutamate (Probable) .

Type

Protein

Source

E.coli

Sequence

MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SLC1A6

Host or Source

Human

Protein Name

Excitatory amino acid transporter 4

Gene Name URL

SLC1A6

Nucleotide Accession Number

NM_001272087.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE anti-mouse CD196 (CCR6)
E16FMP196-025U 25 µg

PE anti-mouse CD196 (CCR6)

Sign In for Pricing
View Details
CD168 Polyclonal Antibody, PE Conjugated
bs-4736R-PE-TR 20 µL

CD168 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Trim10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6490406 1.0 µg DNA

Trim10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Recombinant HRSV Post-F/Fusion glycoprotein F0 Protein, C-His-Strep
VK421021-01 50 µg

Recombinant HRSV Post-F/Fusion glycoprotein F0 Protein, C-His-Strep

Sign In for Pricing
View Details
Recombinant HRSV Post-F/Fusion glycoprotein F0 Protein, C-His-Strep
VK421021-02 100 µg

Recombinant HRSV Post-F/Fusion glycoprotein F0 Protein, C-His-Strep

Sign In for Pricing
View Details
Recombinant HRSV Post-F/Fusion glycoprotein F0 Protein, C-His-Strep
VK421021-03 1 mg

Recombinant HRSV Post-F/Fusion glycoprotein F0 Protein, C-His-Strep

Sign In for Pricing
View Details