Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH-1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Sucrose synthase

Gene Aliases

GRMZM2G089713; sh1; SH-1; shrunken1; shrunken-1; sucrose synthase 1; sucrose-UDP glucosyltransferase 1; ZEAMMB73_Zm00001d045042.

Gene ID

542365

Accession Number

NP_001105411.1

Reactivity

Zea mays

Target

Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways. Most active in the sink tissues where it is responsible for the breakdown of the arriving sucrose.

Type

Protein

Source

E.coli

Sequence

NSEHKFVLKDKKKPIIFSMARLDRVKNMTGLVEMYGKNARLRELANLVIVAGDHGKESKDREEQAEFKKMYSLIDEYKLKGHIRWISAQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVIESMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVNFFDKCKADPSYWDEISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYIEMFYALKYRSLASQVPLSFD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LOC542365

Host or Source

Zea mays

Protein Name

Sucrose synthase 1

Gene Name URL

LOC542365

Nucleotide Accession Number

NM_001111941.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium hydroxide microprills pure EP, NF, E 524 (food and pharma grade)
LC-10912.2 25 Kg

Sodium hydroxide microprills pure EP, NF, E 524 (food and pharma grade)

Sign In for Pricing
View Details
Tas2r131 (NM_207030) Mouse Tagged ORF Clone
MG221291 10 µg

Tas2r131 (NM_207030) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Carbonic Anhydrase VB Protein, Human, Recombinant (His)
TMPY-02133-01 5 µg

Carbonic Anhydrase VB Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Carbonic Anhydrase VB Protein, Human, Recombinant (His)
TMPY-02133-02 10 µg

Carbonic Anhydrase VB Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Carbonic Anhydrase VB Protein, Human, Recombinant (His)
TMPY-02133-03 20 µg

Carbonic Anhydrase VB Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Carbonic Anhydrase VB Protein, Human, Recombinant (His)
TMPY-02133-04 50 µg

Carbonic Anhydrase VB Protein, Human, Recombinant (His)

Sign In for Pricing
View Details