Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cr2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Complement C3d receptor.

Reactivity

Mouse|Mus musculus

Target

Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation.

Type

Protein

Source

E.coli

Sequence

LYGNEVSYECDEGFYLLGEKSLQCVNDSKGHGSWSGPPPQCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVCNQGFIMNGSHLIRCHTNNTWLPGVPTCIRKASLGCQSPSTIPNGNHTGGSIARFPPGMSVMYSCYQGFLMAGEARLICTHEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRFGATVTLECEDGYTLEGSPQSQCQDDSQWNPPLALCKYRRW

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CR2

Host or Source

Mouse

Protein Name

Complement receptor type 2

Gene Name URL

CR2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC5 3'UTR GFP Stable Cell Line
TU077389 1.0 mL

TTC5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Pros1 AAV siRNA Pooled Vector
37742166 1.0 µg

Pros1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
NUDT7 Protein Vector (Rat) (pPM-C-HA)
32304026 500 ng

NUDT7 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
KRT18, CT (Keratin, Type I Cytoskeletal 18, Cytokeratin-18, CK-18, Keratin-18, K18, Cell Proliferation-inducing Gene 46 Protein, PIG46, CYK18) (FITC)
MBS6484242-01 0.2 mL

KRT18, CT (Keratin, Type I Cytoskeletal 18, Cytokeratin-18, CK-18, Keratin-18, K18, Cell Proliferation-inducing Gene 46 Protein, PIG46, CYK18) (FITC)

Sign In for Pricing
View Details
KRT18, CT (Keratin, Type I Cytoskeletal 18, Cytokeratin-18, CK-18, Keratin-18, K18, Cell Proliferation-inducing Gene 46 Protein, PIG46, CYK18) (FITC)
MBS6484242-02 5x 0.2 mL

KRT18, CT (Keratin, Type I Cytoskeletal 18, Cytokeratin-18, CK-18, Keratin-18, K18, Cell Proliferation-inducing Gene 46 Protein, PIG46, CYK18) (FITC)

Sign In for Pricing
View Details
RTL8A (NM_001078172) Human Tagged ORF Clone
RG201312 10 µg

RTL8A (NM_001078172) Human Tagged ORF Clone

Sign In for Pricing
View Details