Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREM2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Triggering receptor expressed on myeloid cells 2

Gene Aliases

PLOSL2; TREM-2; Trem2a; Trem2b; Trem2c; triggering receptor expressed on monocytes 2; triggering receptor expressed on myeloid cells 2; triggering receptor expressed on myeloid cells 2a.

Gene ID

54209

Accession Number

NP_001258750.1

Reactivity

Homo sapiens|Human

Target

Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines.

Type

Protein

Source

E.coli

Sequence

HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TREM2

Host or Source

Human

Protein Name

Triggering receptor expressed on myeloid cells 2

Gene Name URL

TREM2

Nucleotide Accession Number

NM_001271821.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF568 conjugate, 0.1mg/mL
BNC682123-100 1x 100 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF740 conjugate, 0.1mg/mL
BNC741389-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: bilateral
CB508588 1 Block

Frozen Tissue Blocks, Ovary: bilateral

Sign In for Pricing
View Details
Chloroferrocene Carboxaldehyde
TRC-C623480-10MG 10 mg

Chloroferrocene Carboxaldehyde

Sign In for Pricing
View Details
High HAMA Serum and Plasma Matched Set
S2010006P 2x 1 mL

High HAMA Serum and Plasma Matched Set

Sign In for Pricing
View Details
Mouse A930005H10Rik activation kit by CRISPRa
GA207701 1 Kit

Mouse A930005H10Rik activation kit by CRISPRa

Sign In for Pricing
View Details