Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUS1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Sucrose-UDP glucosyltransferase.

Reactivity

Saccharum officinarum|Sugarcane

Target

Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.

Type

Protein

Source

E.coli

Sequence

ARLDRVKNMTGPVEISGKKARLRELANPVIVAGDHGKESKDRDEAEEQGGFKKMYSLIDDYKFKGHIRLISAQMNRVRNGELYQYICDTKGAFVQPAYEAFRLDCDRVHEVRSAKDRDLPWRPCEIIADGVSGLHIDPYHSDKDADILVNFFDKCNADPSYWDEISQGGQRIYEKYTWKLYSERLMTLTGAYGFWNYVSKLERGDTRYIDMFYALEYP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SUS1

Host or Source

Saccharum officinarum

Protein Name

Sucrose synthase

Gene Name URL

SUS1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Nitrophenyl Isocyanate (1-Isocyanato-4-nitrobenzene)
TRC-I798270-2.5G 2.5 g

4-Nitrophenyl Isocyanate (1-Isocyanato-4-nitrobenzene)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Human IgA,  15nm
GAF-351-15 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Human IgA, 15nm

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF594 conjugate, 0.1mg/mL
BNC941527-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(8E)-Dodecen-1-ol
TRC-D525705-500MG 500 mg

(8E)-Dodecen-1-ol

Sign In for Pricing
View Details
Recombinant Rhesus macaque B7-2/CD86 Protein (His Tag)
PKSQ050070-01 10 µg

Recombinant Rhesus macaque B7-2/CD86 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rhesus macaque B7-2/CD86 Protein (His Tag)
PKSQ050070-02 50 µg

Recombinant Rhesus macaque B7-2/CD86 Protein (His Tag)

Sign In for Pricing
View Details