Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUS1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Sucrose-UDP glucosyltransferase.

Reactivity

Saccharum officinarum|Sugarcane

Target

Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.

Type

Protein

Source

E.coli

Sequence

ARLDRVKNMTGPVEISGKKARLRELANPVIVAGDHGKESKDRDEAEEQGGFKKMYSLIDDYKFKGHIRLISAQMNRVRNGELYQYICDTKGAFVQPAYEAFRLDCDRVHEVRSAKDRDLPWRPCEIIADGVSGLHIDPYHSDKDADILVNFFDKCNADPSYWDEISQGGQRIYEKYTWKLYSERLMTLTGAYGFWNYVSKLERGDTRYIDMFYALEYP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SUS1

Host or Source

Saccharum officinarum

Protein Name

Sucrose synthase

Gene Name URL

SUS1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BANF1 (Barrier to Autointegration Factor 1, BAF, BCRP1, D14S1460, MGC111161) (MaxLight 550)
MBS6215981-01 0.1 mL

BANF1 (Barrier to Autointegration Factor 1, BAF, BCRP1, D14S1460, MGC111161) (MaxLight 550)

Sign In for Pricing
View Details
BANF1 (Barrier to Autointegration Factor 1, BAF, BCRP1, D14S1460, MGC111161) (MaxLight 550)
MBS6215981-02 5x 0.1 mL

BANF1 (Barrier to Autointegration Factor 1, BAF, BCRP1, D14S1460, MGC111161) (MaxLight 550)

Sign In for Pricing
View Details
T-Cell Surface Glycoprotein CD8 Beta Chain (CD8B) Antibody
abx170173 1 mL

T-Cell Surface Glycoprotein CD8 Beta Chain (CD8B) Antibody

Sign In for Pricing
View Details
Mouse Human p130 Antibody
orb108605 100 µg

Mouse Human p130 Antibody

Sign In for Pricing
View Details
CMBL Rabbit Polyclonal Antibody
orb625880-01 50 µg

CMBL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CMBL Rabbit Polyclonal Antibody
orb625880-02 100 µg

CMBL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details