What is the catalog number for MTHFD2 Recombinant Protein?

The catalog number for MTHFD2 Recombinant Protein is OPCA03307-1MG.

What sizes are available for MTHFD2 Recombinant Protein?

MTHFD2 Recombinant Protein is available in the following size(s): 1 mg.

Is MTHFD2 Recombinant Protein in stock?

MTHFD2 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

MTHFD2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase

Gene Aliases

Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial; methylene tetrahydrofolate dehydrogenase (NAD+ dependent), methenyltetrahydrofolate cyclohydrolase; methylenetetrahydrofolate dehydrogenase 2.

Gene ID

517539

Accession Number

NP_001069223.1

Reactivity

Bos taurus|Bovine

Target

Although its dehydrogenase activity is NAD-specific, it can also utilize NADP at a reduced efficiency.

Type

Protein

Source

E.coli

Sequence

EAVVISGRKLAEQIKQEVRQEVEEWVASGNKRPHLSVVLVGENPASQSYVLNKTRAAASVGINSETILKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERKVCNAVSPDKDVDGFHVINVGRMCLDQCSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEELKKHTALADIVISAAGIPNLITADMIKEGAAVIDVGINRIQDPITAKPKLVGDVDFEGVKKKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEQEVLKSKELGVASN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

49.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MTHFD2

Host or Source

Bovine

Protein Name

Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial

Gene Name URL

MTHFD2

Nucleotide Accession Number

NM_001075755.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNC741052-100 1x 100 µL