Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDP1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Polyphosphatase DDP1

Gene Aliases

Diadenosine 5',5'''-P1, P6-hexaphosphate hydrolase; Diadenosine and diphosphoinositol polyphosphate phosphohydrolase 1; Diadenosine hexaphosphate hydrolase (AMP-forming) ; polyphosphatase DDP1; YOR163W.

Gene ID

854334

Accession Number

NP_014806.1

Reactivity

Saccharomyces cerevisiae

Target

May eliminate potentially toxic dinucleoside polyphosphates during sporulation. Most active against diadenosine 5',5'''-P1, P6-hexaphosphate (Ap6A) . Can also hydrolyze diadenosine 5',5'''-P1, P5-pentaphosphate (Ap5A), adenosine 5'-pentaphosphate, and adenosine 5'-tetraphosphate are also substrates, but not diadenosine 5',5'''-P1, P4-tetraphosphate (Ap4A) or other dinucleotides, mononucleotides, nucleotide sugars, or nucleotide alcohols. Also cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate) .

Type

Protein

Source

E.coli

Sequence

GKTADNHGPVRSETAREGRENQVYSPVTGARLVAGCICLTPDKKQVLMITSSAHKKRWIVPKGGVEKDEPNYETTAQRETWEEAGCIGKIVANLGTVEDMRPPKDWNKDIKQFENSRKDSEVAKHPPRTEFHFYELEIENLLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLEALNRSAIIKDDK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DDP1

Host or Source

Yeast

Protein Name

Diphosphoinositol polyphosphate phosphohydrolase DDP1

Gene Name URL

DDP1

Nucleotide Accession Number

NM_001183582.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GNL1 Antibody [mFluor Violet 500 SE]
NBP2-98026MFV500 0.1 mL

Rabbit Polyclonal GNL1 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Human IL-27 ELISA Set
MBS335546-01 1x 96 Well

Human IL-27 ELISA Set

Sign In for Pricing
View Details
Human IL-27 ELISA Set
MBS335546-02 5x 96 Well

Human IL-27 ELISA Set

Sign In for Pricing
View Details
Human IL-27 ELISA Set
MBS335546-03 10x 96 Well

Human IL-27 ELISA Set

Sign In for Pricing
View Details
Human IL-27 ELISA Set
MBS335546-04 15x 96 Well

Human IL-27 ELISA Set

Sign In for Pricing
View Details
Human IL-27 ELISA Set
MBS335546-05 20x 96 Well

Human IL-27 ELISA Set

Sign In for Pricing
View Details