Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dlk2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Delta like non-canonical Notch ligand 2

Gene Aliases

AI413481; delta-like 2 homolog; DLK-2; Egfl; Egfl9; EGF-like protein 9; EGF-like-domain, multiple 9; endothelial cell-specific protein S-1; epidermal growth factor-like protein 9; protein delta homolog 2.

Gene ID

106565

Accession Number

NP_001272942.1

Reactivity

Mouse|Mus musculus

Target

Regulates adipogenesis.

Type

Protein

Source

Yeast

Sequence

DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQAGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQESGLGESS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Dlk2

Host or Source

Mouse

Protein Name

Protein delta homolog 2

Gene Name URL

Dlk2

Nucleotide Accession Number

NM_001286013.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit
MBS2020921-01 24 Strip Well

Rat Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit

Sign In for Pricing
View Details
Rat Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit
MBS2020921-02 48 Well

Rat Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit

Sign In for Pricing
View Details
Rat Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit
MBS2020921-03 96 Well

Rat Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit

Sign In for Pricing
View Details
Rat Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit
MBS2020921-04 5x 96 Well

Rat Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit

Sign In for Pricing
View Details
Rat Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit
MBS2020921-05 10x 96 Well

Rat Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Neuronal Pentraxin R/NPTXR Antibody (12) [Janelia Fluor 525]
NBP3-26911JF525 0.1 mL

Mouse Monoclonal Neuronal Pentraxin R/NPTXR Antibody (12) [Janelia Fluor 525]

Sign In for Pricing
View Details