Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ang4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Angiogenin, ribonuclease A family, member 4

Gene Aliases

Angiogenin-4; Raa4; ribonuclease A a4; Rna; Rnase5d.

Gene ID

219033

Accession Number

NP_808212.2

Reactivity

Mouse|Mus musculus

Target

Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro) . Has low ribonuclease activity (in vitro) . Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro) .

Type

Protein

Source

Yeast

Sequence

QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ang4

Host or Source

Mouse

Protein Name

Angiogenin-4

Gene Name URL

Ang4

Nucleotide Accession Number

NM_177544.4

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF71, NT (ZNF71, EZFIT, Endothelial zinc finger protein induced by tumor necrosis factor alpha, Zinc finger protein 71) (Azide free) (HRP)
MBS6367552-01 0.2 mL

ZNF71, NT (ZNF71, EZFIT, Endothelial zinc finger protein induced by tumor necrosis factor alpha, Zinc finger protein 71) (Azide free) (HRP)

Sign In for Pricing
View Details
ZNF71, NT (ZNF71, EZFIT, Endothelial zinc finger protein induced by tumor necrosis factor alpha, Zinc finger protein 71) (Azide free) (HRP)
MBS6367552-02 5x 0.2 mL

ZNF71, NT (ZNF71, EZFIT, Endothelial zinc finger protein induced by tumor necrosis factor alpha, Zinc finger protein 71) (Azide free) (HRP)

Sign In for Pricing
View Details
rno-miR-203b-3p miRNA Antagomir
MNR01279 2x 5.0 nmol

rno-miR-203b-3p miRNA Antagomir

Sign In for Pricing
View Details
GPVI Antibody
253932 0.1 mg

GPVI Antibody

Sign In for Pricing
View Details
Anti Human CD183/CXCR3 Flow Cytometry Monoclonal Clone G025H7 PE/Cyanine7 Ready To Use 200 Tests
IMSAHUCD183G025H7CPECY7200 200 Tests

Anti Human CD183/CXCR3 Flow Cytometry Monoclonal Clone G025H7 PE/Cyanine7 Ready To Use 200 Tests

Sign In for Pricing
View Details
Anti-Epac1/RAPGEF3 Antibody Picoband®, Cy3 Conjugate
A02483-3-Cy3 100 µg/Vial

Anti-Epac1/RAPGEF3 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details