Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKB1-2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Cyclin-dependent kinase B1;2

Gene Aliases

AT2G38620; cyclin-dependent kinase B1;2; T6A23.18; T6A23_18.

Gene ID

818444

Accession Number

NP_001031507.1

Reactivity

Arabidopsis thaliana

Target

Together with CDKB1-1, promotes both the last division in the stomatal cell lineage as well as the number of stomata (PubMed:20675570) . In collaboration with MYB124 and MYB88, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage (PubMed:24123248) .

Type

Protein

Source

Yeast

Sequence

MEKYEKLEKVGEGTYGKVYKAMEKTTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSQSIYIVRLLCVEHVIQSKDSTVSHSPKSNLYLVFEYLDTDLKKFIDSHRKGSNPRPLEASLVQRFMFQLFKGVAHCHSHGVLHRDLKPQNLLLDKDKGILKIADLGLSRAFTVPLKAYTHEIVTLWYRAPEVLLGSTHYSTAVDIWSVGCIFAEMIRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVMALRDWHVYPKWEPQDLSRAVPSLSPEGIDLLTQMLKYNPAERISAKAALDHPYFDSLDKSQF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CDKB1;2

Host or Source

Arabidopsis thaliana

Protein Name

Cyclin-dependent kinase B1-2

Gene Name URL

CDKB1;2

Nucleotide Accession Number

NM_001036430.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CRISPR-Cpf1 Antibody (2D5-6G11) [Alexa Fluor 350]
NBP2-78819AF350 0.1 mL

Mouse Monoclonal CRISPR-Cpf1 Antibody (2D5-6G11) [Alexa Fluor 350]

Sign In for Pricing
View Details
Gm10096 (NM_001102678) Mouse Tagged Lenti ORF Clone
MR212322L3 10 µg

Gm10096 (NM_001102678) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Pggt1b Rabbit Polyclonal Antibody
orb580476 100 µL

Pggt1b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-NDUFS1 Antibody Picoband®
A04920-1 100 µg/Vial

Anti-NDUFS1 Antibody Picoband®

Sign In for Pricing
View Details
Recombinant Pyrococcus abyssi CCA-adding enzyme (cca)
MBS1329316-01 0.02 mg (E-Coli)

Recombinant Pyrococcus abyssi CCA-adding enzyme (cca)

Sign In for Pricing
View Details
Recombinant Pyrococcus abyssi CCA-adding enzyme (cca)
MBS1329316-02 0.02 mg (Yeast)

Recombinant Pyrococcus abyssi CCA-adding enzyme (cca)

Sign In for Pricing
View Details