Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNK2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Potassium two pore domain channel subfamily K member 2

Gene Aliases

HTREK-1c; hTREK-1e; K2p2.1; K2P2.1 potassium channel; outward rectifying potassium channel protein TREK-1; potassium channel subfamily K member 2; potassium channel subfamily k member 2 variant 1; potassium channel subfamily k member 2 variant 2; potassium channel, two pore domain subfamily K, member 2; potassium inwardly-rectifying channel, subfamily K, member 2; tandem-pore-domain potassium channel TREK-1; TPKC1; TREK; TREK1; TREK-1; TREK-1 K (+) channel subunit; TWIK-related potassium channel 1; two pore domain potassium channel TREK-1; two pore potassium channel TPKC1; two-pore potassium channel 1.

Gene ID

3776

Accession Number

NP_001017424.1

Reactivity

Homo sapiens|Human

Target

Ion channel that contributes to passive transmembrane potassium transport (PubMed:23169818) . Reversibly converts between a voltage-insensitive potassium leak channel and a voltage-dependent outward rectifying potassium channel in a phosphorylation-dependent manner (PubMed:11319556) . In astrocytes, forms mostly heterodimeric potassium channels with KCNK1, with only a minor proportion of functional channels containing homodimeric KCNK2. In astrocytes, the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors, such as F2R and CNR1 (By similarity) .

Type

Protein

Source

Yeast

Sequence

MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

KCNK2

Host or Source

Human

Protein Name

Potassium channel subfamily K member 2

Gene Name URL

KCNK2

Nucleotide Accession Number

NM_001017424.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG3 discontinued
386235 200 µL

ATG3 discontinued

Sign In for Pricing
View Details
DCDC5, CT (DCDC5, KIAA1493, Doublecortin domain-containing protein 5) (MaxLight 405)
MBS6291062-01 0.1 mL

DCDC5, CT (DCDC5, KIAA1493, Doublecortin domain-containing protein 5) (MaxLight 405)

Sign In for Pricing
View Details
DCDC5, CT (DCDC5, KIAA1493, Doublecortin domain-containing protein 5) (MaxLight 405)
MBS6291062-02 5x 0.1 mL

DCDC5, CT (DCDC5, KIAA1493, Doublecortin domain-containing protein 5) (MaxLight 405)

Sign In for Pricing
View Details
UBE2B (NM_003337) Human Recombinant Protein
TP303306M 100 µg

UBE2B (NM_003337) Human Recombinant Protein

Sign In for Pricing
View Details
EPCAM Rabbit Polyclonal Antibody
E53P11304 100 µL

EPCAM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
I2PP2A (F-9) Alexa Fluor® 488
sc-133138 AF488 200 µg/mL

I2PP2A (F-9) Alexa Fluor® 488

Sign In for Pricing
View Details