Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFB1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

TGF-beta-1

Reactivity

Oncorhynchus mykiss|Rainbow Trout

Target

Likely to be an important cytokine regulating immune response. May also have a role in other physiological systems.

Type

Protein

Source

Yeast

Sequence

QTTTEEICSDKSESCCVRKLYIDFRKDLGWKWIHEPTGYFANYCIGPCTYIWNTENKYSQVLALYKHHNPGASAQPCCVPQVLEPLPIIYYVGRQHKVEQLSNMIVKSCRCS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

15 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TGFB1

Host or Source

Oncorhynchus mykiss

Protein Name

Transforming growth factor beta-1

Gene Name URL

TGFB1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C16orf88 (KNOP1) activation kit by CRISPRa
GA118271 1 Kit

Human C16orf88 (KNOP1) activation kit by CRISPRa

Sign In for Pricing
View Details
CARS1 Human Gene Knockout Kit (CRISPR)
KN402630 1 Kit

CARS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cardboard Freezer Boxes
R2700-G 5 Units/Pack

Cardboard Freezer Boxes

Sign In for Pricing
View Details
IFNAR1 (NM_000629) Human Over-expression Lysate
LC400212 20 µg

IFNAR1 (NM_000629) Human Over-expression Lysate

Sign In for Pricing
View Details
Aldh1a1 Mouse Gene Knockout Kit (CRISPR)
KN501111 1 Kit

Aldh1a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/2569R), CF405S conjugate, 0.1mg/mL
BNC042569-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/2569R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details