Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HA-17 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Reactivity

Clostridium botulinum

Type

Protein

Source

Yeast

Sequence

SVERTFLPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HA-17

Host or Source

Clostridium botulinum

Protein Name

Hemagglutinin component of the neurotoxin complex

Gene Name URL

HA-17

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Guanine nucleotide-binding protein G (i) subunit alpha-3 (GNAI3)
RPC31786-01 20 µg

Recombinant Human Guanine nucleotide-binding protein G (i) subunit alpha-3 (GNAI3)

Sign In for Pricing
View Details
Recombinant Human Guanine nucleotide-binding protein G (i) subunit alpha-3 (GNAI3)
RPC31786-02 100 µg

Recombinant Human Guanine nucleotide-binding protein G (i) subunit alpha-3 (GNAI3)

Sign In for Pricing
View Details
Recombinant Human Guanine nucleotide-binding protein G (i) subunit alpha-3 (GNAI3)
RPC31786-03 1 mg

Recombinant Human Guanine nucleotide-binding protein G (i) subunit alpha-3 (GNAI3)

Sign In for Pricing
View Details
SNORD114-12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2239407 1.0 µg DNA

SNORD114-12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PTGS2 Antibody (Center P378)
MBS9211267-01 0.08 mL

PTGS2 Antibody (Center P378)

Sign In for Pricing
View Details
PTGS2 Antibody (Center P378)
MBS9211267-02 0.4 mL

PTGS2 Antibody (Center P378)

Sign In for Pricing
View Details