What is the catalog number for Aldh1a1 Recombinant Protein?

The catalog number for Aldh1a1 Recombinant Protein is OPCA03272-1MG.

What sizes are available for Aldh1a1 Recombinant Protein?

Aldh1a1 Recombinant Protein is available in the following size(s): 1 mg.

Is Aldh1a1 Recombinant Protein in stock?

Aldh1a1 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Aldh1a1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Aldehyde dehydrogenase family 1, subfamily A1

Gene Aliases

Ahd; Ahd-; Ahd2; Ahd-2; alcohol dehydrogenase family 1, subfamily A1; alcohol dehydrogenase family 1, subfamily A2; ALD; aldehyde dehydrogenase 1, liver cytosolic (class 1) ; aldehyde dehydrogenase family 1 member A1; aldehyde dehydrogenase, cytosolic; Aldh1; Aldh1a2; ALDH-E1; ALHDII; E1; Ral; RALDH 1; Raldh1; retinal dehydrogenase 1.

Gene ID

11668

Accession Number

NP_038495.2

Reactivity

Mouse|Mus musculus

Target

Can convert/oxidize retinaldehyde to retinoic acid. Binds free retinal and cellular retinol-binding protein-bound retinal (By similarity) . May have a broader specificity and oxidize other aldehydes in vivo (By similarity) .

Type

Protein

Source

Yeast

Sequence

SSPAQPAVPAPLADLKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAGWADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKISQKNS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.