Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aldh1a1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Aldehyde dehydrogenase family 1, subfamily A1

Gene Aliases

Ahd; Ahd-; Ahd2; Ahd-2; alcohol dehydrogenase family 1, subfamily A1; alcohol dehydrogenase family 1, subfamily A2; ALD; aldehyde dehydrogenase 1, liver cytosolic (class 1) ; aldehyde dehydrogenase family 1 member A1; aldehyde dehydrogenase, cytosolic; Aldh1; Aldh1a2; ALDH-E1; ALHDII; E1; Ral; RALDH 1; Raldh1; retinal dehydrogenase 1.

Gene ID

11668

Accession Number

NP_038495.2

Reactivity

Mouse|Mus musculus

Target

Can convert/oxidize retinaldehyde to retinoic acid. Binds free retinal and cellular retinol-binding protein-bound retinal (By similarity) . May have a broader specificity and oxidize other aldehydes in vivo (By similarity) .

Type

Protein

Source

Yeast

Sequence

SSPAQPAVPAPLADLKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAGWADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKISQKNS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

56.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Aldh1a1

Host or Source

Mouse

Protein Name

Retinal dehydrogenase 1

Gene Name URL

Aldh1a1

Nucleotide Accession Number

NM_013467.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCOA5 sgRNA CRISPR Lentivector (Human) (Target 2)
K1400203 1.0 µg DNA

NCOA5 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
WDR6 Knockout Cell Lysate
ABC-KC2322 100 µg

WDR6 Knockout Cell Lysate

Sign In for Pricing
View Details
Human Canopy 2 Homolog (CNPY2) ELISA Kit
YP-W100645-01 48 Tests

Human Canopy 2 Homolog (CNPY2) ELISA Kit

Sign In for Pricing
View Details
Human Canopy 2 Homolog (CNPY2) ELISA Kit
YP-W100645-02 96 Tests

Human Canopy 2 Homolog (CNPY2) ELISA Kit

Sign In for Pricing
View Details
Tris, Ultra Pure Grade
42020236-2 1 kg

Tris, Ultra Pure Grade

Sign In for Pricing
View Details
PCDHGA11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1608407 1.0 µg DNA

PCDHGA11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details