Nqo1 Recombinant Protein

AV001255; azoreductase; Di; Dia4; diaphorase 4 (NADH/NADPH) ; Dtd; DT-diaphorase; menadione reductase; NAD (P) H dehydrogenase (quinone) ; NAD (P) H dehydrogenase [quinone] 1; NAD (P) H menadione oxidoreductase 1, dioxin inducible; NAD (P) H:quinone oxidoreductase 1; NM; Nmo1; Nmo-1; Nmor1; NQ; Ox; Ox-; Ox1; Ox-1; phylloquinone reductase; QR; Qr1; quinone reductase 1.

The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.

AARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.