Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CU Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Dutch elm disease toxin.

Reactivity

Ophiostoma ulmi

Target

Has been implicated in the pathogenicity of this fungus on ELM. Accumulates at, and plugs intercellular openings in the xylem, or interacts with host parenchyma cells, thereby enhancing respiration and electrolyte loss.

Type

Protein

Source

Yeast

Sequence

SDSYDPCTGLLQKSPQCCNTDILGVANLDCHGPPSVPTSPSQFQASCVADGGRSARCCTLSLLGLALVCTDPVGI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

9.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CU

Host or Source

Ophiostoma ulmi

Protein Name

Cerato-ulmin

Gene Name URL

CU

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SP-D/SFTPD, C-His Tag
HA211160-01 20 µg

Human SP-D/SFTPD, C-His Tag

Sign In for Pricing
View Details
Human SP-D/SFTPD, C-His Tag
HA211160-02 50 µg

Human SP-D/SFTPD, C-His Tag

Sign In for Pricing
View Details
Human SP-D/SFTPD, C-His Tag
HA211160-03 100 µg

Human SP-D/SFTPD, C-His Tag

Sign In for Pricing
View Details
Smooth muscle Myosin heavy chain 11 Recombinant Rabbit monoclonal Antibody
HA750417 100 µL

Smooth muscle Myosin heavy chain 11 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TMEM35B Human Gene Knockout Kit (CRISPR)
KN430996 1 Kit

TMEM35B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
R3HCC1 (NM_001136108) Human Over-expression Lysate
LY427802 100 µg

R3HCC1 (NM_001136108) Human Over-expression Lysate

Sign In for Pricing
View Details