Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DERF2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Der f II.

Reactivity

Dermatophagoides farinae

Type

Protein

Source

Yeast

Sequence

DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DERF2

Host or Source

Dermatophagoides farinae

Protein Name

Mite group 2 allergen Der f 2

Gene Name URL

DERF2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rfx2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
38880116 3x 1.0 µg

Rfx2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Lentiviral mouse Socs4 shRNA (UAS) - Lentiviral mouseSocs4 shRNA (UAS, GFP) (25)
GTR15184388 1 Vial

Lentiviral mouse Socs4 shRNA (UAS) - Lentiviral mouseSocs4 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Sgk1, CT (Sgk1, Sgk, Serine/threonine-protein kinase Sgk1, Serum/glucocorticoid-regulated kinase 1) (PE)
MBS6346910-01 0.2 mL

Sgk1, CT (Sgk1, Sgk, Serine/threonine-protein kinase Sgk1, Serum/glucocorticoid-regulated kinase 1) (PE)

Sign In for Pricing
View Details
Sgk1, CT (Sgk1, Sgk, Serine/threonine-protein kinase Sgk1, Serum/glucocorticoid-regulated kinase 1) (PE)
MBS6346910-02 5x 0.2 mL

Sgk1, CT (Sgk1, Sgk, Serine/threonine-protein kinase Sgk1, Serum/glucocorticoid-regulated kinase 1) (PE)

Sign In for Pricing
View Details
Mt4 (NM_001126084) Rat Tagged ORF Clone
RR214590 10 µg

Mt4 (NM_001126084) Rat Tagged ORF Clone

Sign In for Pricing
View Details
PAX6 Ascites Mouse mAb
E2600188 100 µL

PAX6 Ascites Mouse mAb

Sign In for Pricing
View Details