Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DERF2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Der f II.

Reactivity

Dermatophagoides farinae

Type

Protein

Source

Yeast

Sequence

DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DERF2

Host or Source

Dermatophagoides farinae

Protein Name

Mite group 2 allergen Der f 2

Gene Name URL

DERF2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bid BH3 Peptide
orb364375-01 1 mg

Bid BH3 Peptide

Sign In for Pricing
View Details
Bid BH3 Peptide
orb364375-02 5 mg

Bid BH3 Peptide

Sign In for Pricing
View Details
Bid BH3 Peptide
orb364375-03 10 mg

Bid BH3 Peptide

Sign In for Pricing
View Details
Claudin 7 Mouse Monoclonal Antibody [6-G3]
M1412-2 100 µL

Claudin 7 Mouse Monoclonal Antibody [6-G3]

Sign In for Pricing
View Details
REG1A (Regenerating Islet-Derived 1 alpha, ICRF, MGC12447, P19, PSP, PSPS, PSPS1, PTP, REG) (MaxLight 650)
251031-ML650 100 µL

REG1A (Regenerating Islet-Derived 1 alpha, ICRF, MGC12447, P19, PSP, PSPS, PSPS1, PTP, REG) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Larp4 qPCR Primer Pair
QM53530S 200 Tests

Mouse Larp4 qPCR Primer Pair

Sign In for Pricing
View Details