Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Toll like receptor 1

Gene Aliases

CD281; rsc786; TIL; TIL. LPRS5; toll/interleukin-1 receptor-like protein; toll-like receptor 1.

Gene ID

7096

Accession Number

NP_003254.2

Reactivity

Homo sapiens|Human

Target

Participates in the innate immune response to microbial agents. Specifically recognizes diacylated and triacylated lipopeptides. Cooperates with TLR2 to mediate the innate immune response to bacterial lipoproteins or lipopeptides (PubMed:21078852) . Forms the activation cluster TLR2:TLR1:CD14 in response to triacylated lipopeptides, this cluster triggers signaling from the cell surface and subsequently is targeted to the Golgi in a lipid-raft dependent pathway (PubMed:16880211) . Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

Type

Protein

Source

Yeast

Sequence

SEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLKALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNIDQVSSEVLEGWPDSYKCDYPESYRGTLLKDFHMSELSCNIT

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

65.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TLR1

Host or Source

Human

Protein Name

Toll-like receptor 1

Gene Name URL

TLR1

Nucleotide Accession Number

NM_003263.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAPTM4A Protein Vector (Mouse) (pPM-C-His)
PV195813 500 ng

LAPTM4A Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Guinea pig Albumin (ALB) ELISA Kit
RD-ALB-Gu-48Tests 48 Tests

Guinea pig Albumin (ALB) ELISA Kit

Sign In for Pricing
View Details
PCP4L1 (NM_001102566) Human Over-expression Lysate
LH02636V 100 µg

PCP4L1 (NM_001102566) Human Over-expression Lysate

Sign In for Pricing
View Details
LINGO2v (LINGO2, LERN3, LRRN6C, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2, Leucine-rich repeat neuronal protein 3, Leucine-rich repeat neuronal protein 6C) (MaxLight 650)
MBS6316358-01 0.1 mL

LINGO2v (LINGO2, LERN3, LRRN6C, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2, Leucine-rich repeat neuronal protein 3, Leucine-rich repeat neuronal protein 6C) (MaxLight 650)

Sign In for Pricing
View Details
LINGO2v (LINGO2, LERN3, LRRN6C, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2, Leucine-rich repeat neuronal protein 3, Leucine-rich repeat neuronal protein 6C) (MaxLight 650)
MBS6316358-02 5x 0.1 mL

LINGO2v (LINGO2, LERN3, LRRN6C, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2, Leucine-rich repeat neuronal protein 3, Leucine-rich repeat neuronal protein 6C) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral mouse Pak7 shRNA (UAS) - Lentiviral mousePak7 shRNA (UAS, GFP) (25)
GTR15258356 1 Vial

Lentiviral mouse Pak7 shRNA (UAS) - Lentiviral mousePak7 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details