Disintegrin halysin Recombinant Protein
Product Specifications
CAS Number
9000-83-3
Gene Aliases
Platelet aggregation activation inhibitor.
Reactivity
Gloydius blomhoffii
Target
Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.
Type
Protein
Source
Yeast
Sequence
EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKKGTVCRIARGDDMDDYCNGISAGCPRNPF
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
9.5 kDa
Protein Length
Recombinant
Host or Source
Gloydius blomhoffii
Protein Name
Disintegrin halysin
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY418518 100 µg
NABC1 (BCAS1) (NM_003657) Human Over-expression Lysate
Sign In for Pricing
View Details 
MBS6490137-01 0.1 mL
Nm23, NT (Nonmetastatic Protein 23, AWD, Granzyme A Activated DNase, GZMA Activated DNase, GAAD, Metastasis Inhibition Factor nm23, NB, NBS, NM23-H1, NM23-H1B, Non-metastatic Cells 1 Protein, NME1, Nucleoside Diphosphate Kinase A, NDP Kinase A, NDK A, NDK
Sign In for Pricing
View Details MBS6490137-02 5x 0.1 mL
Nm23, NT (Nonmetastatic Protein 23, AWD, Granzyme A Activated DNase, GZMA Activated DNase, GAAD, Metastasis Inhibition Factor nm23, NB, NBS, NM23-H1, NM23-H1B, Non-metastatic Cells 1 Protein, NME1, Nucleoside Diphosphate Kinase A, NDP Kinase A, NDK A, NDK
Sign In for Pricing
View Details