What is the catalog number for Tgfb1 Recombinant Protein?

The catalog number for Tgfb1 Recombinant Protein is OPCA03225-100UG.

What sizes are available for Tgfb1 Recombinant Protein?

Tgfb1 Recombinant Protein is available in the following size(s): 100 µg.

Is Tgfb1 Recombinant Protein in stock?

Tgfb1 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Tgfb1 Recombinant Protein

Selected Variant

OPCA03225-100UG

Size: 100 µg

Product Specifications

CAS Number

9000-83-3

Gene Name

Transforming growth factor beta 1 L homeolog

Gene Aliases

Ced; dpd1; lap; tgf beta; tgfb; tgfb1; tgfb5; tgfbeta; tgf-beta; tgf-beta 5; TGF-beta-1; TGF-beta5; TGF-beta-5; transforming gorwth factor-Beta5; transforming growth factor beta-1 proprotein; transforming growth factor-B5; transforming growth factor-beta 5 (TGF-beta 5) ; XELAEV_18039344mg.

Gene ID

397778

Accession Number

NP_001081330.1

Reactivity

Xenopus laevis

Target

Important role in certain aspects of differentiation.

Type

Protein

Source

E.coli

Sequence

GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Tgfb1.L

Host or Source

Xenopus laevis

Protein Name

Transforming growth factor beta-1

Gene Name URL

Tgfb1.L

Nucleotide Accession Number

NM_001087861.1

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cytochrome P450 2E1/CYP2E1 Antibody Picoband® (monoclonal, 2C7G1)

M00672-2 100 µg/Vial