Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pepsin inhibitor 3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

PI-3

Reactivity

Ascaris suum

Target

This is an inhibitor of the aspartic protease pepsin.

Type

Protein

Source

E.coli

Sequence

QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.4 kDa

Protein Length

Recombinant

Host or Source

Ascaris suum

Protein Name

Major pepsin inhibitor 3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCA (Grancalcin, GCL) (AP)
MBS6131435-01 0.1 mL

GCA (Grancalcin, GCL) (AP)

Sign In for Pricing
View Details
GCA (Grancalcin, GCL) (AP)
MBS6131435-02 5x 0.1 mL

GCA (Grancalcin, GCL) (AP)

Sign In for Pricing
View Details
Bisindolylmaleimide I, HCl
sc-24004 1 mg

Bisindolylmaleimide I, HCl

Sign In for Pricing
View Details
KLF10 ORF Vector (Human) (pORF)
ORF005691 1.0 µg DNA

KLF10 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
rBAT CRISPR Activation Plasmid (m)
sc-423005-ACT 20 µg

rBAT CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
ZIM2 Protein Lysate
OCOA20764-20UG 20 µg

ZIM2 Protein Lysate

Sign In for Pricing
View Details