Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Toxin MIT1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Black mamba intestinal toxin 1; Black mamba venom protein A.

Reactivity

Black Mamba|Dendroaspis polylepis

Target

Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2 (PubMed:12054613) . Potently contracts gastrointestinal (GI) smooth muscle (PubMed:10567694) .

Type

Protein

Source

E.coli

Sequence

AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

24.6 kDa

Protein Length

Recombinant

Host or Source

Dendroaspis polylepis polylepis

Protein Name

Toxin MIT1

More Discoveries

Explore Other Products

Browse additional items from our catalog

10 mL Serological Pipette with 3.0ml negative graduation, 1/10 ml graduations, Sterile, 20 per bulk bag, 500/pk, 1500/cs
CS0019-327002 1 Each

10 mL Serological Pipette with 3.0ml negative graduation, 1/10 ml graduations, Sterile, 20 per bulk bag, 500/pk, 1500/cs

Sign In for Pricing
View Details
Merlin (Ab-518)
ANTY021258 100ug

Merlin (Ab-518)

Sign In for Pricing
View Details
Biotinylated Anti-KLRG1 (ulviprubart biosimilar) mAb
12-9393B-50 50 µg

Biotinylated Anti-KLRG1 (ulviprubart biosimilar) mAb

Sign In for Pricing
View Details
MRPL20 Rabbit Polyclonal Antibody
TA315562 100 µL

MRPL20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PMS2P6 Protein Vector (Human) (pPB-N-His)
PV112027 500 ng

PMS2P6 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CCDC66 shRNA (h) Lentiviral Particles
sc-78499-V 200 µL

CCDC66 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details