What is the catalog number for Toxin MIT1 Recombinant Protein?

The catalog number for Toxin MIT1 Recombinant Protein is OPCA03204-1MG.

What sizes are available for Toxin MIT1 Recombinant Protein?

Toxin MIT1 Recombinant Protein is available in the following size(s): 1 mg.

Is Toxin MIT1 Recombinant Protein in stock?

Toxin MIT1 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Toxin MIT1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Black mamba intestinal toxin 1; Black mamba venom protein A.

Reactivity

Black Mamba|Dendroaspis polylepis

Target

Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2 (PubMed:12054613) . Potently contracts gastrointestinal (GI) smooth muscle (PubMed:10567694) .

Type

Protein

Source

E.coli

Sequence

AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.