Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UL111A Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

CmvIL-10 vIL-10

Reactivity

Human cytomegalovirus|Human Herpesvirus 5

Target

Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells.

Type

Protein

Source

E.coli

Sequence

SEEAKPATTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34 kda

Protein Length

Recombinant

NCBI Gene Symbol

UL111A

Host or Source

Human cytomegalovirus

Protein Name

Viral interleukin-10 homolog

Gene Name URL

UL111A

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Genomic DNA, Colon
CD565250 5 µg

Tissue Genomic DNA, Colon

Sign In for Pricing
View Details
3-amino-1,1,1-trifluoro-4-phenylbutan-2-one
sc-346256A 5 g

3-amino-1,1,1-trifluoro-4-phenylbutan-2-one

Sign In for Pricing
View Details
FAM71D Protein Vector (Mouse) (pPM-C-HA)
PV178092 500 ng

FAM71D Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Zygote Arrest 1 (ZAR1) Antibody (Biotin)
abx333615-01 20 µg

Zygote Arrest 1 (ZAR1) Antibody (Biotin)

Sign In for Pricing
View Details
Zygote Arrest 1 (ZAR1) Antibody (Biotin)
abx333615-02 50 µg

Zygote Arrest 1 (ZAR1) Antibody (Biotin)

Sign In for Pricing
View Details
Zygote Arrest 1 (ZAR1) Antibody (Biotin)
abx333615-03 100 µg

Zygote Arrest 1 (ZAR1) Antibody (Biotin)

Sign In for Pricing
View Details