Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DMA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Major histocompatibility complex, class II, DM alpha

Gene Aliases

Class II histocompatibility antigen, M alpha chain; D6S222E; DMA; HLA class II histocompatibility antigen, DM alpha chain; HLADM; MHC class II antigen DMA; really interesting new gene 6 protein; RING6.

Gene ID

3108

Accession Number

NP_006111.2

Reactivity

Homo sapiens|Human

Target

HLA-DMA belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta chain (DMB), both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages) . The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail.

Type

Protein

Source

E.coli

Sequence

VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HLA-DMA

Host or Source

Human

Protein Name

HLA-DMA protein

Gene Name URL

HLA-DMA

Nucleotide Accession Number

NM_006120.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytochrome P450 2B1 2B2 Antibody (b/e4) [DyLight 550]
NBP2-50202R 0.1 mL

Mouse Monoclonal Cytochrome P450 2B1 2B2 Antibody (b/e4) [DyLight 550]

Sign In for Pricing
View Details
SPDYE4 Recombinant Protein (Rat)
RP230726 100 µg

SPDYE4 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Recombinant human TCEB1 protein
ATGP1363-100 100 µg

Recombinant human TCEB1 protein

Sign In for Pricing
View Details
PON2 (NM_001018161) Human Tagged ORF Clone
RG222678 10 µg

PON2 (NM_001018161) Human Tagged ORF Clone

Sign In for Pricing
View Details
ST13 (NM_003932) Human Mass Spec Standard
PH320533 10 µg

ST13 (NM_003932) Human Mass Spec Standard

Sign In for Pricing
View Details
Recombinant Human TCF4 Protein, His, E.coli-2ug
QP13710-HIS-EC-2ug 2ug

Recombinant Human TCF4 Protein, His, E.coli-2ug

Sign In for Pricing
View Details