Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Icam4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Intercellular adhesion molecule 4, Landsteiner-Wiener blood group

Gene Aliases

1810015M19Rik; Cd242; ICAM-4; intercellular adhesion molecule 4; LW glycoprotein.

Gene ID

78369

Accession Number

NP_076381.1

Reactivity

Mouse|Mus musculus

Target

Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2) . ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity) . Isoform 2 may modulate binding of membrane-associated ICAM4.

Type

Protein

Source

E.coli

Sequence

QQEWMQSPPAPSVTSAPFWVRLNPELEAVPPGGSAWLNCSHNCPLPVHSSLRTQLRQGKIVNGSGWVSYQLLDVRAWNSKVRCVVTCAGETREATARITAYKRPRSVILEPPVLVGHKYTLRCYVTHVFPVGFLVVSLRRGGRVIYHESLERFTGSDLANVTLTYVMRAGLNDLWQPLTCHARLNLDGLVVRSSSAPVMLTVLALSPAS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Icam4

Host or Source

Mouse

Protein Name

Intercellular adhesion molecule 4

Gene Name URL

Icam4

Nucleotide Accession Number

NM_023892.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

General PCP Matched Antibody Pair Set [RMD1/RCR63]
Z01LS-0523-LS985 5 Plates

General PCP Matched Antibody Pair Set [RMD1/RCR63]

Sign In for Pricing
View Details
Rat Cluster of Differentiation 44 ELISA Kit
MBS012844-01 48 Well

Rat Cluster of Differentiation 44 ELISA Kit

Sign In for Pricing
View Details
Rat Cluster of Differentiation 44 ELISA Kit
MBS012844-02 96 Well

Rat Cluster of Differentiation 44 ELISA Kit

Sign In for Pricing
View Details
Rat Cluster of Differentiation 44 ELISA Kit
MBS012844-03 5x 96 Well

Rat Cluster of Differentiation 44 ELISA Kit

Sign In for Pricing
View Details
Rat Cluster of Differentiation 44 ELISA Kit
MBS012844-04 10x 96 Well

Rat Cluster of Differentiation 44 ELISA Kit

Sign In for Pricing
View Details
Tctex1d1 siRNA Oligos set (Rat)
46429176 3x 5 nmol

Tctex1d1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details