Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aac Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Aculeacin-A acylase small subunit Aculeacin-A acylase large subunit

Reactivity

Actinoplanes utahensis

Target

Catalyzes the hydrolysis of the palmitoyl moiety of the antifungal antibiotic, aculeacin-A, giving a hexapeptide moiety and a long chain fatty acid.

Type

Protein

Source

E.coli

Sequence

GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANGERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRDQMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVRAGSGALLDGIVAATPPTAAGPASAPEAPDA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AAC

Host or Source

Actinoplanes utahensis

Protein Name

Aculeacin-A acylase

Gene Name URL

AAC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM FITC Antibody Labeling Kit, 1x (50-100ug) labeling
#92296 1 Kit

Mix-n-StainTM FITC Antibody Labeling Kit, 1x (50-100ug) labeling

Sign In for Pricing
View Details
APC Anti-Human CD44 Antibody[HI44a]
AN00335E-01 20 Tests

APC Anti-Human CD44 Antibody[HI44a]

Sign In for Pricing
View Details
APC Anti-Human CD44 Antibody[HI44a]
AN00335E-02 100 Tests

APC Anti-Human CD44 Antibody[HI44a]

Sign In for Pricing
View Details
APC Anti-Human CD44 Antibody[HI44a]
AN00335E-03 2x 100 Tests

APC Anti-Human CD44 Antibody[HI44a]

Sign In for Pricing
View Details
Bisphenol F-d10
TRC-B519557-1MG 1 mg

Bisphenol F-d10

Sign In for Pricing
View Details
Mouse Nos1 activation kit by CRISPRa
GA202933 1 Kit

Mouse Nos1 activation kit by CRISPRa

Sign In for Pricing
View Details