Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aac Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Aculeacin-A acylase small subunit Aculeacin-A acylase large subunit

Reactivity

Actinoplanes utahensis

Target

Catalyzes the hydrolysis of the palmitoyl moiety of the antifungal antibiotic, aculeacin-A, giving a hexapeptide moiety and a long chain fatty acid.

Type

Protein

Source

E.coli

Sequence

GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANGERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRDQMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVRAGSGALLDGIVAATPPTAAGPASAPEAPDA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AAC

Host or Source

Actinoplanes utahensis

Protein Name

Aculeacin-A acylase

Gene Name URL

AAC

More Discoveries

Explore Other Products

Browse additional items from our catalog

BECN2 Rabbit Polyclonal Antibody
TA349109 100 µg

BECN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NOXA1 (NM_006647) Human Over-expression Lysate
LY416502 100 µg

NOXA1 (NM_006647) Human Over-expression Lysate

Sign In for Pricing
View Details
X123 Lentiviral Activation Particles (h)
sc-411279-LAC 200 µL

X123 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
CD44 Mouse Monoclonal Antibody [Clone ID: LBI2E3]
AMM13991V 100 µL

CD44 Mouse Monoclonal Antibody [Clone ID: LBI2E3]

Sign In for Pricing
View Details
PSMA4 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-12260R-APC-Cy5.5 100 µL

PSMA4 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Fndc1 shRNA (UAS) - Lentiviral mouse Fndc1 shRNA (UAS) (25)
GTR15147137 1 Vial

Lentiviral mouse Fndc1 shRNA (UAS) - Lentiviral mouse Fndc1 shRNA (UAS) (25)

Sign In for Pricing
View Details