Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Oxyopinin-4a Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Oxt-4a

Reactivity

Oxyopes takobius

Target

Disrupts cell membranes through the formation of pores (Probable) . Has antibacterial activity against Gram-positive bacteria S.aureus (MIC=10 uM) and B.subtilis (MIC=0.5 uM) as well as Gram-negative bacteria P.fluorescens (MIC=1 uM) and E.coli (MIC=0.5 uM) . Has hemolytic activity against human erythrocytes (EC (50) =7 uM) .

Type

Protein

Source

E.coli

Sequence

GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.6 kDa

Protein Length

Recombinant

Host or Source

Oxyopes takobius

Protein Name

Oxyopinin-4a

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Gallinacin-11 ELISA Kit
MBS7258719-01 48 Well

Goat Gallinacin-11 ELISA Kit

Sign In for Pricing
View Details
Goat Gallinacin-11 ELISA Kit
MBS7258719-02 96 Well

Goat Gallinacin-11 ELISA Kit

Sign In for Pricing
View Details
Goat Gallinacin-11 ELISA Kit
MBS7258719-03 5x 96 Well

Goat Gallinacin-11 ELISA Kit

Sign In for Pricing
View Details
Goat Gallinacin-11 ELISA Kit
MBS7258719-04 10x 96 Well

Goat Gallinacin-11 ELISA Kit

Sign In for Pricing
View Details
EXT1 CRISPR/Cas9 KO Plasmid (h)
sc-404635 20 µg

EXT1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Rat Nerve Growth Factor IB (NGFIB) ELISA Kit
RDR-NGFIB-Ra-01 96 Tests

Rat Nerve Growth Factor IB (NGFIB) ELISA Kit

Sign In for Pricing
View Details