Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Oxyopinin-4a Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Oxt-4a

Reactivity

Oxyopes takobius

Target

Disrupts cell membranes through the formation of pores (Probable) . Has antibacterial activity against Gram-positive bacteria S.aureus (MIC=10 uM) and B.subtilis (MIC=0.5 uM) as well as Gram-negative bacteria P.fluorescens (MIC=1 uM) and E.coli (MIC=0.5 uM) . Has hemolytic activity against human erythrocytes (EC (50) =7 uM) .

Type

Protein

Source

E.coli

Sequence

GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.6 kDa

Protein Length

Recombinant

Host or Source

Oxyopes takobius

Protein Name

Oxyopinin-4a

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Luteinizing Hormone-Releasing Hormone, free acid, human; LH-RH, free acid, human
5-01479 4x 5 mg

Luteinizing Hormone-Releasing Hormone, free acid, human; LH-RH, free acid, human

Sign In for Pricing
View Details
DCC (Center) Rabbit Polyclonal Antibody
AP51195PU-N 400 µL

DCC (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium Vanbaalenii rpsK Protein (aa 1-137)
VAng-Yyj5132-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Vanbaalenii rpsK Protein (aa 1-137)

Sign In for Pricing
View Details
Mouse Integrin alpha-2, Itga2 ELISA KIT
ELI-12855m 96 Tests

Mouse Integrin alpha-2, Itga2 ELISA KIT

Sign In for Pricing
View Details
Anti-Zebrafish MRC1A Antibody Picoband® HRP Conjugated
AZA0A0R4INM0-HRP 100 µg/Vial

Anti-Zebrafish MRC1A Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
6-Bromo-3-iodo-1H- pyrrolo[3,2-b]pyridine
CSB-DT4961 1 g

6-Bromo-3-iodo-1H- pyrrolo[3,2-b]pyridine

Sign In for Pricing
View Details