What is the catalog number for LptD Recombinant Protein?

The catalog number for LptD Recombinant Protein is OPCA03163-100UG.

What sizes are available for LptD Recombinant Protein?

LptD Recombinant Protein is available in the following size(s): 100 µg.

Is LptD Recombinant Protein in stock?

LptD Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

LptD Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Organic solvent tolerance protein

Gene Aliases

Imp; STY0108.

Gene ID

1246607

Accession Number

NP_454705.1

Reactivity

Salmonella enterica|Salmonella typhi

Target

Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane.

Type

Protein

Source

E.coli

Sequence

VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

26.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

STY0108

Host or Source

Salmonella typhi

Protein Name

LPS-assembly protein LptD

Gene Name URL

STY0108

Nucleotide Accession Number

NC_003198.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

BNC942216-500 1x 500 µL