Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Znf346 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Zinc finger protein 346

Gene Aliases

Jaz; just another zinc finger protein; zinc finger protein 346; Znf346.

Gene ID

26919

Accession Number

NP_036147.1

Reactivity

Mouse|Mus musculus

Target

Binds with low affinity to dsDNA and ssRNA, and with high affinity to dsRNA, with no detectable sequence specificity (By similarity) (PubMed:10488071) . May bind to specific miRNA hairpins (By similarity) .

Type

Protein

Source

E.coli

Sequence

MECPAPDATDAADPGEAGPYKGSEEPEGREPDGVRFDRERARRLWEAVSGAQPAGREEVEHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETIKGDVKRLDSDQKSSRSKDKNHCCPICNMTFSSPAVAQSHYLGKTHAKSLKLKQQSTKGAALQQNREMLDPDKFCSLCHSTFNDPAMAQQHYMGKRHRKQETKLKLMAHYGRLADPAVSDLPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTLVTLGSQTPVQTQPTPKDSSTVQD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Zfp346

Host or Source

Mouse

Protein Name

Zinc finger protein 346

Gene Name URL

Zfp346

Nucleotide Accession Number

NM_012017.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Rat sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit
E-UNEL-R0088-01 5x 96 Tests

Uncoated Rat sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit
E-UNEL-R0088-02 15x 96 Tests

Uncoated Rat sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit

Sign In for Pricing
View Details
FRG2 (NM_001005217) Human Over-expression Lysate
LC423808 20 µg

FRG2 (NM_001005217) Human Over-expression Lysate

Sign In for Pricing
View Details
CD44v6 (Marker of Tumor Metastasis) (2F10), CF594 conjugate, 0.1mg/mL
BNC941629-100 1x 100 µL

CD44v6 (Marker of Tumor Metastasis) (2F10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human C6orf191 (TMEM244) activation kit by CRISPRa
GA116749 1 Kit

Human C6orf191 (TMEM244) activation kit by CRISPRa

Sign In for Pricing
View Details
Apolipoprotein H (APOH) Mouse Monoclonal Antibody [Clone ID: OTI4A11]
CF807147 100 µg

Apolipoprotein H (APOH) Mouse Monoclonal Antibody [Clone ID: OTI4A11]

Sign In for Pricing
View Details