Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF11 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Growth differentiation factor 11

Gene Aliases

BMP11; BMP-11; bone morphogenetic protein 11; GDF-11; growth/differentiation factor 11; VHO.

Gene ID

10220

Accession Number

NP_005802.1

Reactivity

Homo sapiens|Human

Target

Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. May play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern (By similarity) . Signals through activin receptors type-2, ACVR2A and ACVR2B, and activin receptors type-1, ACVR1B, ACVR1C and TGFBR1 leading to the phosphorylation of SMAD2 and SMAD3 (PubMed:28257634) .

Type

Protein

Source

E.coli

Sequence

NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GDF11

Host or Source

Human

Protein Name

Growth/differentiation factor 11

Gene Name URL

GDF11

Nucleotide Accession Number

NM_005811.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Nuf2 shRNA (UAS) - Lentiviral mouse Nuf2 shRNA (UAS, GFP) (100)
GTR15200601 1 Vial

Lentiviral mouse Nuf2 shRNA (UAS) - Lentiviral mouse Nuf2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Myo-inositol oxygenase CRISPR Activation Plasmid (m)
sc-425278-ACT 20 µg

Myo-inositol oxygenase CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
CD11a (ITGAL) Mouse Monoclonal Antibody [Clone ID: MEM-25]
BM4046 200 µg

CD11a (ITGAL) Mouse Monoclonal Antibody [Clone ID: MEM-25]

Sign In for Pricing
View Details
Zfp719 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4956503 1.0 µg DNA

Zfp719 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CTXN3 Protein Vector (Rat) (pPM-C-His)
PV262405 500 ng

CTXN3 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Anti-Human CD63/LAMP3 Antibody (SAA1394), PE
MBS1583002-01 50 Tests

Anti-Human CD63/LAMP3 Antibody (SAA1394), PE

Sign In for Pricing
View Details