Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scn Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

SCIN

Accession Number

WP_000702262.1

Reactivity

Staphylococcus aureus

Target

Involved in countering the first line of host defense mechanisms. Efficiently inhibits opsonization, phagocytosis and killing of S.aureus by human neutrophils. Acts by binding and stabilizing human C3 convertases (C4b2a and C3bBb), leading to their inactivation. The convertases are no longer able to cleave complement C3, therefore preventing further C3b deposition on the bacterial surface and phagocytosis of the bacterium. Also prevents C5a-induced neutrophil responses (By similarity) .

Type

Protein

Source

E.coli

Sequence

STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

25.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SCN

Host or Source

Staphylococcus aureus

Protein Name

Staphylococcal complement inhibitor

Gene Name URL

SCN

Nucleotide Accession Number

NC_002745.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B-[1- (Tetrahydro-2H-pyran-4-yl) -1H-pyrazol-4-yl]boronic Acid
sc-474014 100 mg

B-[1- (Tetrahydro-2H-pyran-4-yl) -1H-pyrazol-4-yl]boronic Acid

Sign In for Pricing
View Details
AMPD1 Conjugated Antibody
C34409 100 µL

AMPD1 Conjugated Antibody

Sign In for Pricing
View Details
Helicobacter pylori (Rabbit PAb), CF740 conjugate, 0.1mg/mL
BNC740374-100 1x 100 µL

Helicobacter pylori (Rabbit PAb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant human PDH kinase 1/PDK1 protein
PDK0904-020 20 µg

Recombinant human PDH kinase 1/PDK1 protein

Sign In for Pricing
View Details
NDN (Necdin Homolog (mouse), HsT16328, PWCR) (Biotin)
249180-Biotin 100 µL

NDN (Necdin Homolog (mouse), HsT16328, PWCR) (Biotin)

Sign In for Pricing
View Details
HSP70 Monoclonal Antibody (3G10)
orb1415984 100 µL

HSP70 Monoclonal Antibody (3G10)

Sign In for Pricing
View Details