Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pal Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

19 kDa surface antigen; PPL.

Accession Number

WP_010947759.1

Reactivity

Legionella pneumophila

Target

Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity (By similarity) . Very strongly associated with the peptidoglycan.

Type

Protein

Source

E.coli

Sequence

CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PAL

Host or Source

Legionella pneumophila

Protein Name

Peptidoglycan-associated lipoprotein

Gene Name URL

PAL

Nucleotide Accession Number

NZ_JRMJ01000023.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

20 (S),24 (R) -Ocotillol
TN1220 5 mg

20 (S),24 (R) -Ocotillol

Sign In for Pricing
View Details
Fastk sgRNA CRISPR Lentivector (Rat) (Target 3)
K6350004 1.0 µg DNA

Fastk sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
NCRNA00086 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1401906 1.0 µg DNA

NCRNA00086 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Mouse Periostin / POSTN Protein (His tag)
E53A07712 50 µg

Recombinant Mouse Periostin / POSTN Protein (His tag)

Sign In for Pricing
View Details
CRTC3 Recombinant Antibody, HRP Conjugated
bsm-62571R-HRP-01 20 µL

CRTC3 Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
CRTC3 Recombinant Antibody, HRP Conjugated
bsm-62571R-HRP-02 100 µL

CRTC3 Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details