Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DERF2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Der f II.

Reactivity

Dermatophagoides farinae

Type

Protein

Source

E.coli

Sequence

DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DERF2

Host or Source

Dermatophagoides farinae

Protein Name

Mite group 2 allergen Der f 2

Gene Name URL

DERF2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3 η Lentiviral Activation Particles (h2)
sc-402892-LAC-2 200 µL

14-3-3 η Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
CA II Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61561R-BF680-TR 20 µL

CA II Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Total PSA/tPSA Monoclonal Mouse Monoclonal Antibody
orb2956132-01 50 µg

Total PSA/tPSA Monoclonal Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Total PSA/tPSA Monoclonal Mouse Monoclonal Antibody
orb2956132-02 100 µg

Total PSA/tPSA Monoclonal Mouse Monoclonal Antibody

Sign In for Pricing
View Details
UBE2L4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
48982061 1.0 µg DNA

UBE2L4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ZKSCAN1 3'UTR GFP Stable Cell Line
TU078891 1.0 mL

ZKSCAN1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details