DERF2 Recombinant Protein
Product Specifications
CAS Number
9000-83-3
Gene Aliases
Allergen Der f II.
Reactivity
Dermatophagoides farinae
Type
Protein
Source
E.coli
Sequence
DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
30.1 kDa
Protein Length
Recombinant
NCBI Gene Symbol
DERF2
Host or Source
Dermatophagoides farinae
Protein Name
Mite group 2 allergen Der f 2
Gene Name URL
DERF2
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Dimethylaniline monooxygenase [N-oxide-forming] 5 (FMO5) Mouse ELISA Kit](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
C9041 96 Tests
Dimethylaniline monooxygenase [N-oxide-forming] 5 (FMO5) Mouse ELISA Kit
Sign In for Pricing
View Details MBS755327-01 48 Well
Bovine Palate, lung, and nasal epithelium carcinoma associated protein ELISA Kit
Sign In for Pricing
View Details MBS755327-02 96 Well
Bovine Palate, lung, and nasal epithelium carcinoma associated protein ELISA Kit
Sign In for Pricing
View Details MBS755327-03 5x 96 Well
Bovine Palate, lung, and nasal epithelium carcinoma associated protein ELISA Kit
Sign In for Pricing
View Details MBS755327-04 10x 96 Well
Bovine Palate, lung, and nasal epithelium carcinoma associated protein ELISA Kit
Sign In for Pricing
View Details