Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BLOT5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen: Blo t 5

Reactivity

Blomia tropicalis

Type

Protein

Source

E.coli

Sequence

MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BLOT5

Host or Source

Blomia tropicalis

Protein Name

Mite allergen Blo t 5

Gene Name URL

BLOT5

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTFR1L (NM_001099627) Human Over-expression Lysate
LC420466 20 µg

MTFR1L (NM_001099627) Human Over-expression Lysate

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD62L Antibody[HI62L]
E-AB-F1336G-01 20 Tests

PE/Cyanine5 Anti-Human CD62L Antibody[HI62L]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD62L Antibody[HI62L]
E-AB-F1336G-02 100 Tests

PE/Cyanine5 Anti-Human CD62L Antibody[HI62L]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD62L Antibody[HI62L]
E-AB-F1336G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD62L Antibody[HI62L]

Sign In for Pricing
View Details
KAT8 Rabbit Polyclonal Antibody
TA377688 100 µL

KAT8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HYPK Human Gene Knockout Kit (CRISPR)
KN400840 1 Kit

HYPK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details