Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BLOT5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen: Blo t 5

Reactivity

Blomia tropicalis

Type

Protein

Source

E.coli

Sequence

MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BLOT5

Host or Source

Blomia tropicalis

Protein Name

Mite allergen Blo t 5

Gene Name URL

BLOT5

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ablim1 Rat shRNA Lentiviral Particle (Locus ID 307989)
TL703754V 500 µL Each

Ablim1 Rat shRNA Lentiviral Particle (Locus ID 307989)

Sign In for Pricing
View Details
Rabbit Monoclonal Pax5/BSAP Antibody (1207C) [Alexa Fluor 594]
FAB3487T 0.1 mL

Rabbit Monoclonal Pax5/BSAP Antibody (1207C) [Alexa Fluor 594]

Sign In for Pricing
View Details
USP16 (NM_001001992) Human Tagged ORF Clone Lentiviral Particle
RC205268L1V 200 µL

USP16 (NM_001001992) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Brucella Suis slyX Protein (strain 1330) (aa 1-68)
VAng-Lsx5586-50gEcoli 50 µg (E. coli)

Recombinant Brucella Suis slyX Protein (strain 1330) (aa 1-68)

Sign In for Pricing
View Details
DEFB115 Human qPCR Primer Pair (NM_001037730)
HP203203 200 Reactions

DEFB115 Human qPCR Primer Pair (NM_001037730)

Sign In for Pricing
View Details
Nori® Canine HGFR ELISA Kit
GR115518 96 Well

Nori® Canine HGFR ELISA Kit

Sign In for Pricing
View Details