Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytotoxin 4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Cardiotoxin A4; Cardiotoxin analog IV.

Reactivity

Naja atra

Target

Basic protein that bind to cell membrane and depolarizes cardiomyocytes. This cytotoxin also shows lytic activities, but 2-fold more important than that of CTX-A2. It binds to the integrin alpha-V/beta-3 with a moderate affinity. Inhibits protein kinase C. It may interact with sulfatides in the cell membrane, which induces pore formation and cell internalization and is responsible for cytotoxicity in cardiomyocytes. It also may target the mitochondrial membrane and induces mitochondrial swelling and fragmentation.

Type

Protein

Source

E.coli

Sequence

RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22.8 kDa

Protein Length

Recombinant

Host or Source

Naja atra

Protein Name

Cytotoxin 4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-363-5p miRNA Antagomir
CIN0916-01 10 nmol

Mmu-miR-363-5p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-363-5p miRNA Antagomir
CIN0916-02 20 nmol

Mmu-miR-363-5p miRNA Antagomir

Sign In for Pricing
View Details
Rabbit Anti-NU214/NUP214 Polyclonal Antibody
PAV2624 100 μL

Rabbit Anti-NU214/NUP214 Polyclonal Antibody

Sign In for Pricing
View Details
ENO1 Antibody
orb520387-01 50 μL

ENO1 Antibody

Sign In for Pricing
View Details
ENO1 Antibody
orb520387-02 100 µL

ENO1 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS715975 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details