Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tst Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

TSST-1

Reactivity

Staphylococcus aureus

Target

Responsible for the symptoms of toxic shock syndrome.

Type

Protein

Source

E.coli

Sequence

STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TST

Host or Source

Staphylococcus aureus

Protein Name

Toxic shock syndrome toxin-1

Gene Name URL

TST

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF799 Pre-designed siRNA Set B
SI019087B 1 Each

Human ZNF799 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Bovine Delta (14) -sterol reductase, TM7SF2 ELISA Kit
MBS9333866-01 48 Well

Bovine Delta (14) -sterol reductase, TM7SF2 ELISA Kit

Sign In for Pricing
View Details
Bovine Delta (14) -sterol reductase, TM7SF2 ELISA Kit
MBS9333866-02 96 Well

Bovine Delta (14) -sterol reductase, TM7SF2 ELISA Kit

Sign In for Pricing
View Details
Bovine Delta (14) -sterol reductase, TM7SF2 ELISA Kit
MBS9333866-03 5x 96 Well

Bovine Delta (14) -sterol reductase, TM7SF2 ELISA Kit

Sign In for Pricing
View Details
Bovine Delta (14) -sterol reductase, TM7SF2 ELISA Kit
MBS9333866-04 10x 96 Well

Bovine Delta (14) -sterol reductase, TM7SF2 ELISA Kit

Sign In for Pricing
View Details
Rpsa-set siRNA/shRNA/RNAi Lentivector (Mouse)
42659094 4x 500 ng

Rpsa-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details