Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tst Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

TSST-1

Reactivity

Staphylococcus aureus

Target

Responsible for the symptoms of toxic shock syndrome.

Type

Protein

Source

E.coli

Sequence

STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TST

Host or Source

Staphylococcus aureus

Protein Name

Toxic shock syndrome toxin-1

Gene Name URL

TST

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP19 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
30240064 1.0 µg DNA

MMP19 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Anaphase promoting complex subunit 13 (ANAPC13) ELISA Kit
MBS7242355-01 48 Well

Human Anaphase promoting complex subunit 13 (ANAPC13) ELISA Kit

Sign In for Pricing
View Details
Human Anaphase promoting complex subunit 13 (ANAPC13) ELISA Kit
MBS7242355-02 96 Well

Human Anaphase promoting complex subunit 13 (ANAPC13) ELISA Kit

Sign In for Pricing
View Details
Human Anaphase promoting complex subunit 13 (ANAPC13) ELISA Kit
MBS7242355-03 5x 96 Well

Human Anaphase promoting complex subunit 13 (ANAPC13) ELISA Kit

Sign In for Pricing
View Details
Human Anaphase promoting complex subunit 13 (ANAPC13) ELISA Kit
MBS7242355-04 10x 96 Well

Human Anaphase promoting complex subunit 13 (ANAPC13) ELISA Kit

Sign In for Pricing
View Details
Mest 3'UTR Lenti-reporter-Luc Vector
28373086 1.0 µg

Mest 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details