Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LevanaseÀšÃ‚ Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

2,6-beta-D-fructan fructanohydrolase; Endo-levanase.

Reactivity

Bacillus

Target

Catalyzes the hydrolysis of levan with endo-type specificity. The products of levan hydrolysis are a mixture of fructose and a series of fructooligosaccharides up to 12-mer, with levantriose being the major oligosaccharide obtained. Is not active towards sucrose.

Type

Protein

Source

E.coli

Sequence

LPWNDLGHVWSGSAVADTTNASGLFGSSGGKGLIAYYTSYNPDRHNGNQKIGLAYSTDRGRTWKYSEEHPVVIENPGKTGEDPGGWDFRDPKVVRDEANNRWVMVVSGGDHIRLFTSTNLLNWTLTDQF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.3 kDa

Protein Length

Recombinant

Host or Source

Bacillus sp.

Protein Name

Levanase

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dph3 ORF Vector (Rat) (pORF)
ORF066193 1.0 µg DNA

Dph3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
CNK1 Lentiviral Activation Particles (m2)
sc-431454-LAC-2 200 µL

CNK1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Connexin 32 shRNA (m) Lentiviral Particles
sc-43077-V 200 µL

Connexin 32 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
RARRES2 ELISA Kit (Human) : 96 Wells (OKEH02884)
OKEH02884 96 Well

RARRES2 ELISA Kit (Human) : 96 Wells (OKEH02884)

Sign In for Pricing
View Details
ALK Antibody
33146-01 50 µL

ALK Antibody

Sign In for Pricing
View Details
ALK Antibody
33146-02 100 µL

ALK Antibody

Sign In for Pricing
View Details