Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YPT1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Rab family GTPase YPT1

Gene Aliases

Protein YP2; Rab family GTPase YPT1; Rab GTPase YPT1; Transport GTPase YPT1; YFL038C.

Gene ID

850505

Accession Number

NP_116615.1

Reactivity

Saccharomyces cerevisiae

Target

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. YPT1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Vesicular transport depends on shuttling of YPT1 between membrane and cytosol by GDI1, probably by recycling it to its membrane of origin after a vesicle fusion event. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins.

Type

Protein

Source

E.coli

Sequence

MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

YPT1

Host or Source

Yeast

Protein Name

GTP-binding protein YPT1

Gene Name URL

YPT1

Nucleotide Accession Number

NM_001179928.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Silver (Ag) ICP Standard Solution 1.0 gm/L In 5% HNO3 Traceable To NIST-1000 ppm 5% v/v Nitric Acid
ICP187 00125 125 mL

Silver (Ag) ICP Standard Solution 1.0 gm/L In 5% HNO3 Traceable To NIST-1000 ppm 5% v/v Nitric Acid

Sign In for Pricing
View Details
Topoisomerase II β (TOP2b) Human ELISA Kit
H6743 96 Tests

Topoisomerase II β (TOP2b) Human ELISA Kit

Sign In for Pricing
View Details
NBD-557
MBS5752516 Inquire

NBD-557

Sign In for Pricing
View Details
Recombinant Rat Cytochrome P450 1A2 (Cyp1a2)
MBS1209912-01 0.02 mg (E-Coli)

Recombinant Rat Cytochrome P450 1A2 (Cyp1a2)

Sign In for Pricing
View Details
Recombinant Rat Cytochrome P450 1A2 (Cyp1a2)
MBS1209912-02 0.02 mg (Yeast)

Recombinant Rat Cytochrome P450 1A2 (Cyp1a2)

Sign In for Pricing
View Details
Recombinant Rat Cytochrome P450 1A2 (Cyp1a2)
MBS1209912-03 0.1 mg (E-Coli)

Recombinant Rat Cytochrome P450 1A2 (Cyp1a2)

Sign In for Pricing
View Details