Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fcgr3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Fc-gamma RIII.

Reactivity

Mouse|Mus musculus

Target

Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor which binds to IgG1, IgG2a and IgG2b (PubMed:17558411) . Mediates neutrophil activation by IgG complexes redundantly with Fcgr4 (PubMed:18097064) .

Type

Protein

Source

E.coli

Sequence

ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FCGR3

Host or Source

Mouse

Protein Name

Low affinity immunoglobulin gamma Fc region receptor III

Gene Name URL

FCGR3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Misato Homolog 1 (MSTO1)
MBS2026295-01 0.1 mL

Polyclonal Antibody to Misato Homolog 1 (MSTO1)

Sign In for Pricing
View Details
Polyclonal Antibody to Misato Homolog 1 (MSTO1)
MBS2026295-02 0.2 mL

Polyclonal Antibody to Misato Homolog 1 (MSTO1)

Sign In for Pricing
View Details
Polyclonal Antibody to Misato Homolog 1 (MSTO1)
MBS2026295-03 0.5 mL

Polyclonal Antibody to Misato Homolog 1 (MSTO1)

Sign In for Pricing
View Details
Polyclonal Antibody to Misato Homolog 1 (MSTO1)
MBS2026295-04 1 mL

Polyclonal Antibody to Misato Homolog 1 (MSTO1)

Sign In for Pricing
View Details
Polyclonal Antibody to Misato Homolog 1 (MSTO1)
MBS2026295-05 5 mL

Polyclonal Antibody to Misato Homolog 1 (MSTO1)

Sign In for Pricing
View Details
Polyclonal Antibody to Misato Homolog 1 (MSTO1)
MBS2026295-06 5x 5 mL

Polyclonal Antibody to Misato Homolog 1 (MSTO1)

Sign In for Pricing
View Details