What is the catalog number for Nkx2-2 Recombinant Protein?

The catalog number for Nkx2-2 Recombinant Protein is OPCA03134-20UG.

What sizes are available for Nkx2-2 Recombinant Protein?

Nkx2-2 Recombinant Protein is available in the following size(s): 20 µg.

Is Nkx2-2 Recombinant Protein in stock?

Nkx2-2 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Nkx2-2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

NK2 homeobox 2

Gene Aliases

Drosophila NK2 transcription factor related, locus 2; glycoprotein GP330, renal; homeobox protein NK-2 homolog B; homeobox protein Nkx-2.2; homeobox protein Nkx2-2; NK2 transcription factor related, locus 2; Nkx2.; Nkx-2.; Nkx2.2; Nkx-2.2; ti; tinman.

Gene ID

18088

Accession Number

NP_035049.1

Reactivity

Mouse|Mus musculus

Target

Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter.

Type

Protein

Source

E.coli

Sequence

MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.